LL-37 specifications and research profile
Specifications summary
| Designation | Human cathelicidin host-defence peptide |
|---|---|
| Also known as | LL-37; hCAP18-derived peptide |
| Sequence / composition | [LL-37, 37 aa] |
| Strength | 5mg × 10 vials |
| Presentation | 10-vial case |
| Purity | 99%+ HPLC |
| Storage | Store refrigerated at 2-8 C, protected from light. |
| COA | Batch document added when available |
Description and research context
LL-37 is a 37-amino-acid cationic peptide cleaved from the human cathelicidin precursor hCAP18. Its charge and inducible helical structure make it a reference for membrane and host-defence research.
Published work has examined bacterial membrane permeabilisation, lipopolysaccharide binding and ERK/p38 signalling in primary human cells. Responses vary with salt, serum, membrane composition and concentration.
Applications in research
- Microbial-membrane permeabilisation assays
- LPS binding and peptide-conformation studies
- ERK, p38 and innate-immune signalling models
Precautions and interpretation
For controlled laboratory research only. Not for human or veterinary use. The cited findings come from specific biochemical, cellular, structural or preclinical models and must not be treated as usage guidance or evidence of a defined outcome outside those models.
Research references
LL-37 research record
Clear product, batch, storage, dispatch and document information for this 10-vial case.
Research context
A 37-amino-acid cationic host-defence peptide studied in microbial-membrane, lipopolysaccharide-binding and innate-immune signalling models.
Product record
The listing identifies the presentation, specification, storage record, dispatch status, and COA availability for the relevant product or batch.
Use restriction
For laboratory research use only. Not for human or veterinary consumption. No use instructions or therapeutic guidance is provided.