Select the image to view the label in detail.
LL-37 research profile
What is being studied?
LL-37 is a 37-amino-acid cationic peptide cleaved from the human cathelicidin precursor hCAP18. Its charge and inducible helical structure make it a reference for membrane and host-defence research.
Published work has examined bacterial membrane permeabilisation, lipopolysaccharide binding and ERK/p38 signalling in primary human cells. Responses vary with salt, serum, membrane composition and concentration.
Research areas
- Microbial-membrane permeabilisation assays
- LPS binding and peptide-conformation studies
- ERK, p38 and innate-immune signalling models
Selected studies
How to read this research
These papers study defined compounds in specific experimental systems or clinical trials. They do not test or certify this product, its batch or its prepared presentation. Component and related-peptide studies do not establish the effects of a finished blend. Findings are research context, not evidence of safety or suitability for personal use. For laboratory research only; no treatment, dosing or use advice is provided.
LL-37 research record
Molecular identity and stated sequence or composition, alongside the batch, storage, dispatch and document record for this 10-vial case.
Molecular identity
Human cathelicidin host-defence peptide
Sequence / composition
[LL-37, 37 aa]
Product record
The listing identifies the presentation, specification, storage record, dispatch status, and batch-document availability for the relevant product or batch.
Use restriction
For laboratory research use only. Not for human or veterinary consumption. No use instructions or therapeutic guidance is provided.